BLAST Search

No file chosen

Note

  • The BLAST database includes all Daphnia species in annotated by iDaphnia as well as other representative species annotated by NCBI: Acyrthosiphon pisum, Aedes aegypti, Apis mellifera, Argiope bruennichi, Bombyx mori, Caenorhabditis elegans, Centruroides sculpturatus, Cimex lectularius, Danio rerio, Drosophila melanogaster, Eurytemora affinis, Homo sapiens, Limulus polyphemus, Macrobrachium nipponense, Mus musculus, Parasteatoda tepidariorum, Parhyale hawaiensis, Rhopalosiphum maidis, Strigamia maritima, Tigriopus californicus, Tribolium castaneum. We support sequence similarity searches for mRNA (only for NCBI-annotated species), CDS, or protein sequences. Each search is limited to 100 sequences.

FASTA format

  • A sequence begins with a greater-than character (">") followed by a description of the sequence (all in a single line). The lines immediately following the description line are the sequence representation, with one letter per amino acid or nucleic acid, and are typically no more than 80 characters in length.

    For example:

    >Protein:DPULMPP000003-001 | Gene:DPULMPG000003 DPULMP_1_chr.1:11349..12038:+[Daphnia pulex KAP4]

    MWNEEESYLEDVKKHTFTTNIHTIHSSPGKSSSESLEVGLTKRKDVKPNLLEQGETVSKSYLERVKDQTVLILFTSKNKVYYV RLTGDGSPDGNLNFSLIKGANCKNVGMAVVNENANIVTILVLWSDGELVQYSEQGAIMVAYNLSGICLTSPVAMVMLDTVRM*